PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009790299.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 812aa    MW: 87319.3 Da    PI: 5.9145
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009790299.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10340400262
                     XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                     ++ k+  r+ +NRe+A+ sRqRKk ++eeLe+kv  + +  ++L  ++  +  e a+lk++
  XP_009790299.1 340 EDEKKRARLVRNRESAQLSRQRKKHYVEELEDKVRIMHSTIQDLNAKVAYIIAENATLKTQ 400
                     5678999*******************************99999999998888888888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.4E-14339403IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.197341401IPR004827Basic-leucine zipper domain
PfamPF001701.5E-10342400IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-15343401No hitNo description
SuperFamilySSF579596.88E-12343401No hitNo description
CDDcd147042.63E-20344395No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MAGPILADPP PSAAANSTGE FEGLPIPPLD PTYFAQHMTA ADQGKIDGFP MELPEGDEFM  60
LDDLDFDLSF DDIFLNNGDA VLNPDFLADC LGSDTDRVDP SFYGQPGNQL IENFDNSSGE  120
EPPGSKFVPA DLNCFGQPGS QLVRDFDDSS RYFKSTSAEF CDFSGNQAAG GVMVMDTSSP  180
ELRQSSSGSD VLNATSSTSS HQVSGDVAGY LNVPSPESNG SNHEGSRESA NDNKGLGDAR  240
VLNCHSPESQ GSGNYGSNVS EGLNYPSDSN KSVHSSPNFE NNSIKNGAVE EKIKLEGVNA  300
NISKCSSLLK RKKSSEDSNN INIHQKLTNV ALSDNVNNDE DEKKRARLVR NRESAQLSRQ  360
RKKHYVEELE DKVRIMHSTI QDLNAKVAYI IAENATLKTQ LGGAGVPSQV PPPPPGMYPH  420
HPVMYPWMPY TPPYMVKPQG SQVPLVPIPK LKPQGAAPAP KSSKKVEKKR TQVKTKKVAS  480
VSFLGLLFFM LLFGGLVPLL NVRYGGTREP FMSGDSFWSG SYEKHQGRVL AVDGPVNGTG  540
HSGKYGGNDF SSHCSRRGQD ESAQPNVNGS DPLAASLYVP RNDKLVKIDG NLIIHSVLAS  600
EKAMASHGGA DKNNRETGLA VPEDLAPAIA GSHPHLYRST AVGQRVLGTG EENGKSTVQQ  660
WFLEGVAGPL LSSGMCTEVF QFDVSSSAPG AVVPATNTRN LSMEERQNAT RVHKVRNRRI  720
LNGHSVTLSR PSHNISEEQT GKQENFSGNK SLSSMVVSVL VDPREGGDGD VDGMMGPKSL  780
SRIFVVVLID SVKYVTYSCM LPFKGSVPLV TT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1705718RQNATRVHKVRNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX164500.0X16450.1 Tobacco mRNA for TGA1b DNA-binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790299.10.0PREDICTED: uncharacterized protein LOC104237777
RefseqXP_016511623.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLM1AAQ50.0M1AAQ5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000184860.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30292450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-116bZIP family protein